Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3F3N9

Protein Details
Accession A0A0C3F3N9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-89VLRSLETQRKKNRKRLGKETVTSHydrophilic
NLS Segment(s)
PositionSequence
75-81RKKNRKR
Subcellular Location(s) mito 16.5, mito_nucl 11.5, nucl 5.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MNNIPKPQVGIRSRMLRSRRPPRAGSGNVATSARTGAPIPCSVCFFVGGTVRWLISEALKEALKEEVLRSLETQRKKNRKRLGKETVTSAQNKMSATSRTTWMKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.56
4 0.63
5 0.68
6 0.72
7 0.7
8 0.7
9 0.69
10 0.73
11 0.67
12 0.62
13 0.55
14 0.47
15 0.42
16 0.39
17 0.31
18 0.22
19 0.19
20 0.14
21 0.1
22 0.09
23 0.08
24 0.1
25 0.13
26 0.14
27 0.13
28 0.15
29 0.15
30 0.14
31 0.14
32 0.12
33 0.11
34 0.12
35 0.11
36 0.11
37 0.11
38 0.1
39 0.09
40 0.1
41 0.08
42 0.07
43 0.07
44 0.07
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.11
54 0.12
55 0.13
56 0.14
57 0.2
58 0.26
59 0.31
60 0.39
61 0.45
62 0.55
63 0.63
64 0.72
65 0.75
66 0.8
67 0.84
68 0.86
69 0.86
70 0.84
71 0.79
72 0.76
73 0.73
74 0.68
75 0.61
76 0.52
77 0.44
78 0.37
79 0.35
80 0.3
81 0.27
82 0.25
83 0.26
84 0.27
85 0.31