Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DHP8

Protein Details
Accession E9DHP8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
39-62GSKAPDPRLRPKRRGKNAIHAERCBasic
NLS Segment(s)
PositionSequence
40-54SKAPDPRLRPKRRGK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MQAQSGMNPIQPNSGSRTDLSTLSRQLYPSTRRHEAEGGSKAPDPRLRPKRRGKNAIHAERCAEEEQGGDFGFLSGVSKFVIQGLSLAKSPPSVRDVSAREGLATP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.27
5 0.25
6 0.26
7 0.28
8 0.27
9 0.26
10 0.27
11 0.28
12 0.25
13 0.26
14 0.3
15 0.33
16 0.36
17 0.4
18 0.43
19 0.43
20 0.45
21 0.45
22 0.41
23 0.42
24 0.39
25 0.33
26 0.29
27 0.3
28 0.27
29 0.27
30 0.28
31 0.25
32 0.31
33 0.41
34 0.47
35 0.54
36 0.64
37 0.72
38 0.78
39 0.84
40 0.78
41 0.78
42 0.81
43 0.81
44 0.74
45 0.64
46 0.55
47 0.46
48 0.44
49 0.34
50 0.24
51 0.14
52 0.11
53 0.11
54 0.1
55 0.09
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.06
70 0.08
71 0.1
72 0.11
73 0.12
74 0.12
75 0.12
76 0.14
77 0.15
78 0.17
79 0.19
80 0.19
81 0.2
82 0.27
83 0.31
84 0.34
85 0.38
86 0.35