Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3B679

Protein Details
Accession A0A0C3B679    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSLRARRPHRDKDKIHNVDABasic
NLS Segment(s)
Subcellular Location(s) plas 12, nucl 10, golg 3
Family & Domain DBs
Amino Acid Sequences MSLRARRPHRDKDKIHNVDARSSKFSDVNGCQNNDSPTIVNGNIIIMINFPSRPKGVIIIIFSFCFFLETRVLGCCDEQTHLQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.75
4 0.65
5 0.63
6 0.61
7 0.54
8 0.47
9 0.42
10 0.38
11 0.33
12 0.32
13 0.3
14 0.28
15 0.33
16 0.33
17 0.33
18 0.31
19 0.33
20 0.33
21 0.27
22 0.25
23 0.17
24 0.13
25 0.13
26 0.12
27 0.1
28 0.09
29 0.07
30 0.07
31 0.06
32 0.06
33 0.04
34 0.05
35 0.06
36 0.07
37 0.07
38 0.09
39 0.09
40 0.1
41 0.11
42 0.11
43 0.13
44 0.15
45 0.17
46 0.18
47 0.19
48 0.18
49 0.18
50 0.16
51 0.14
52 0.13
53 0.1
54 0.1
55 0.1
56 0.11
57 0.12
58 0.13
59 0.15
60 0.14
61 0.15
62 0.15
63 0.15
64 0.17