Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AQU9

Protein Details
Accession A0A0C3AQU9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MKEREKVQEKRKKEERKRKKREAFITRHVAEBasic
NLS Segment(s)
PositionSequence
6-21KVQEKRKKEERKRKKR
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MKEREKVQEKRKKEERKRKKREAFITRHVAEIIQRQEFILKLTRALVMFGGLSHRLQAQIQVTARVLDLLNSAVCIYQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.94
5 0.95
6 0.95
7 0.93
8 0.93
9 0.92
10 0.89
11 0.86
12 0.84
13 0.74
14 0.64
15 0.54
16 0.44
17 0.34
18 0.32
19 0.26
20 0.18
21 0.17
22 0.16
23 0.17
24 0.16
25 0.16
26 0.15
27 0.12
28 0.11
29 0.12
30 0.14
31 0.13
32 0.13
33 0.11
34 0.07
35 0.07
36 0.07
37 0.08
38 0.07
39 0.07
40 0.08
41 0.08
42 0.08
43 0.09
44 0.12
45 0.12
46 0.17
47 0.18
48 0.2
49 0.2
50 0.19
51 0.19
52 0.17
53 0.15
54 0.1
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09