Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3C048

Protein Details
Accession A0A0C3C048    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-35LTNNHPPVRNGRPQKKKKQHVGRLKNSYPFFHydrophilic
NLS Segment(s)
PositionSequence
14-24NGRPQKKKKQH
Subcellular Location(s) mito_nucl 13.333, mito 13, nucl 11.5, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MWGSLTNNHPPVRNGRPQKKKKQHVGRLKNSYPFFKWERQLLQLTGLLRYWQTWPVKWSQKLGMSCQDTDNETNSVDVLRRETRVDTGREASEKQKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.69
4 0.77
5 0.86
6 0.89
7 0.91
8 0.92
9 0.92
10 0.92
11 0.92
12 0.93
13 0.92
14 0.9
15 0.85
16 0.81
17 0.73
18 0.67
19 0.57
20 0.52
21 0.46
22 0.42
23 0.4
24 0.37
25 0.37
26 0.37
27 0.38
28 0.32
29 0.3
30 0.26
31 0.23
32 0.19
33 0.16
34 0.13
35 0.1
36 0.1
37 0.1
38 0.13
39 0.14
40 0.14
41 0.16
42 0.23
43 0.31
44 0.32
45 0.34
46 0.33
47 0.38
48 0.38
49 0.4
50 0.4
51 0.35
52 0.35
53 0.33
54 0.3
55 0.26
56 0.26
57 0.25
58 0.18
59 0.15
60 0.14
61 0.13
62 0.13
63 0.12
64 0.11
65 0.14
66 0.16
67 0.17
68 0.19
69 0.21
70 0.26
71 0.31
72 0.33
73 0.33
74 0.34
75 0.37
76 0.38
77 0.39
78 0.37