Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3C6S7

Protein Details
Accession A0A0C3C6S7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
126-151FEKVRIAEGKKKTPKREKNENEFINGHydrophilic
NLS Segment(s)
PositionSequence
134-141GKKKTPKR
Subcellular Location(s) nucl 12, cyto 7.5, cyto_mito 7, mito 5.5
Family & Domain DBs
Amino Acid Sequences MAPKRKSDAMEQTTLDLPPLAVLANSKEVNVDASAAEPVAKKSRVTDASASTSKGKGKAAPRDWKDIKLDGEDEIRALQKTSGWKITQWLKDIGGINSNSYGRFMKASGPTEGATNGTYKAAYIYFEKVRIAEGKKKTPKREKNENEFINGIPLEDRRRMWVFGPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.33
3 0.22
4 0.16
5 0.11
6 0.1
7 0.07
8 0.05
9 0.07
10 0.08
11 0.14
12 0.14
13 0.14
14 0.14
15 0.14
16 0.15
17 0.15
18 0.13
19 0.08
20 0.08
21 0.08
22 0.08
23 0.09
24 0.08
25 0.1
26 0.15
27 0.16
28 0.16
29 0.18
30 0.26
31 0.27
32 0.3
33 0.31
34 0.3
35 0.35
36 0.36
37 0.36
38 0.3
39 0.29
40 0.28
41 0.26
42 0.24
43 0.23
44 0.29
45 0.37
46 0.43
47 0.51
48 0.52
49 0.59
50 0.6
51 0.58
52 0.54
53 0.48
54 0.41
55 0.33
56 0.3
57 0.22
58 0.21
59 0.17
60 0.14
61 0.12
62 0.11
63 0.09
64 0.09
65 0.07
66 0.08
67 0.11
68 0.13
69 0.17
70 0.16
71 0.16
72 0.2
73 0.28
74 0.29
75 0.28
76 0.27
77 0.24
78 0.27
79 0.28
80 0.24
81 0.21
82 0.18
83 0.16
84 0.17
85 0.17
86 0.13
87 0.13
88 0.13
89 0.1
90 0.1
91 0.1
92 0.14
93 0.18
94 0.21
95 0.21
96 0.22
97 0.22
98 0.21
99 0.21
100 0.17
101 0.13
102 0.11
103 0.1
104 0.09
105 0.08
106 0.08
107 0.08
108 0.08
109 0.09
110 0.1
111 0.14
112 0.16
113 0.17
114 0.18
115 0.17
116 0.19
117 0.23
118 0.26
119 0.3
120 0.35
121 0.45
122 0.54
123 0.63
124 0.71
125 0.77
126 0.82
127 0.83
128 0.87
129 0.87
130 0.88
131 0.9
132 0.82
133 0.75
134 0.67
135 0.57
136 0.51
137 0.4
138 0.3
139 0.22
140 0.22
141 0.22
142 0.25
143 0.25
144 0.27
145 0.31
146 0.32