Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3FN24

Protein Details
Accession A0A0C3FN24    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-57QGVAKKQLPKKPKKGIKPKEVEMBasic
NLS Segment(s)
PositionSequence
39-53KKQLPKKPKKGIKPK
Subcellular Location(s) cyto_nucl 12.333, nucl 12, cyto 11.5, mito_nucl 6.833
Family & Domain DBs
Amino Acid Sequences KRMKAAIEKVWEQMGVDHKAAITAHDAQCAVLLMQGVAKKQLPKKPKKGIKPKEVEMSESKPEIEGSDEDDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.21
4 0.2
5 0.18
6 0.19
7 0.19
8 0.16
9 0.13
10 0.15
11 0.16
12 0.17
13 0.17
14 0.15
15 0.16
16 0.15
17 0.12
18 0.06
19 0.06
20 0.04
21 0.06
22 0.07
23 0.07
24 0.08
25 0.09
26 0.13
27 0.19
28 0.25
29 0.34
30 0.43
31 0.53
32 0.62
33 0.7
34 0.76
35 0.82
36 0.86
37 0.86
38 0.84
39 0.8
40 0.79
41 0.71
42 0.65
43 0.59
44 0.54
45 0.48
46 0.41
47 0.35
48 0.27
49 0.26
50 0.22
51 0.2
52 0.15
53 0.16
54 0.19