Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3EQ02

Protein Details
Accession A0A0C3EQ02    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-29QSIVLVKRTSRRTRREHRPVVEDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVKRTSRRTRREHRPVVEDSTNVRAFQFQIALPFMGNLLDVSFRIHDFVFWWEENVVSYGYITAFSHMSDDTVIACINRHGYYAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.58
4 0.65
5 0.75
6 0.84
7 0.87
8 0.88
9 0.83
10 0.8
11 0.75
12 0.72
13 0.64
14 0.54
15 0.45
16 0.42
17 0.36
18 0.3
19 0.26
20 0.19
21 0.18
22 0.17
23 0.16
24 0.09
25 0.1
26 0.11
27 0.11
28 0.1
29 0.09
30 0.08
31 0.06
32 0.06
33 0.04
34 0.03
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.07
44 0.09
45 0.12
46 0.12
47 0.13
48 0.12
49 0.12
50 0.12
51 0.12
52 0.1
53 0.07
54 0.07
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.09
63 0.08
64 0.09
65 0.08
66 0.08
67 0.07
68 0.08
69 0.08
70 0.07
71 0.08
72 0.09
73 0.12
74 0.13