Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ASR5

Protein Details
Accession A0A0C3ASR5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
103-124AFSELAKKEKWRRCPKCSAMVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, mito 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031127  E3_UB_ligase_RBR  
IPR002867  IBR_dom  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004842  F:ubiquitin-protein transferase activity  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF01485  IBR  
Amino Acid Sequences MVEIGDMIARLVLGDGNLDEWNHARFMSTLNIIYCPHKGCNEPFDANDVAPAPEGTTHAKSLVQCPRCRKTLCKDCKVVWHDKLTCEEYQALPLNERAPEDLAFSELAKKEKWRRCPKCSAMVELKVSLVSNPSTSPPRFHSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.07
4 0.08
5 0.08
6 0.09
7 0.1
8 0.11
9 0.11
10 0.1
11 0.1
12 0.09
13 0.12
14 0.14
15 0.15
16 0.16
17 0.16
18 0.18
19 0.19
20 0.2
21 0.21
22 0.2
23 0.2
24 0.2
25 0.23
26 0.24
27 0.28
28 0.31
29 0.3
30 0.28
31 0.3
32 0.28
33 0.25
34 0.23
35 0.18
36 0.13
37 0.11
38 0.11
39 0.07
40 0.06
41 0.08
42 0.1
43 0.11
44 0.11
45 0.12
46 0.13
47 0.14
48 0.2
49 0.27
50 0.29
51 0.32
52 0.39
53 0.42
54 0.46
55 0.48
56 0.46
57 0.48
58 0.53
59 0.58
60 0.58
61 0.58
62 0.54
63 0.61
64 0.61
65 0.57
66 0.5
67 0.49
68 0.44
69 0.42
70 0.44
71 0.39
72 0.34
73 0.28
74 0.26
75 0.18
76 0.2
77 0.22
78 0.18
79 0.16
80 0.17
81 0.17
82 0.16
83 0.17
84 0.14
85 0.12
86 0.12
87 0.13
88 0.12
89 0.11
90 0.11
91 0.11
92 0.14
93 0.15
94 0.16
95 0.16
96 0.23
97 0.32
98 0.4
99 0.51
100 0.58
101 0.65
102 0.71
103 0.81
104 0.8
105 0.81
106 0.77
107 0.74
108 0.71
109 0.68
110 0.62
111 0.52
112 0.46
113 0.36
114 0.32
115 0.24
116 0.19
117 0.14
118 0.12
119 0.13
120 0.17
121 0.23
122 0.24
123 0.29