Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3F3D1

Protein Details
Accession A0A0C3F3D1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRRIPVWRRLRQTRRICYISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 7, E.R. 3, cyto 2, extr 2, pero 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKRRIPVWRRLRQTRRICYISRQLHAAPLRRAVGRLASDTLWLKGVIVILVFSALLRARDNEATTLRATVDCTSRREI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.8
4 0.73
5 0.69
6 0.7
7 0.66
8 0.57
9 0.52
10 0.43
11 0.44
12 0.47
13 0.45
14 0.37
15 0.34
16 0.34
17 0.31
18 0.31
19 0.25
20 0.23
21 0.19
22 0.18
23 0.16
24 0.13
25 0.15
26 0.15
27 0.14
28 0.12
29 0.1
30 0.09
31 0.08
32 0.08
33 0.06
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.03
40 0.04
41 0.05
42 0.06
43 0.07
44 0.08
45 0.12
46 0.14
47 0.16
48 0.18
49 0.19
50 0.2
51 0.2
52 0.2
53 0.18
54 0.16
55 0.17
56 0.17
57 0.22
58 0.24