Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3FMF5

Protein Details
Accession A0A0C3FMF5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
146-171KAEEEEREKKKKKNEKKLEVKAAKAKBasic
NLS Segment(s)
PositionSequence
141-190KRKLTKAEEEEREKKKKKNEKKLEVKAAKAKEQNNKQATWQKFAKKSEKK
Subcellular Location(s) nucl 18.5, mito_nucl 11.5, mito 3.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010304  SMN_Tudor  
IPR002999  Tudor  
IPR043560  ZGPAT  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0003723  F:RNA binding  
GO:0006397  P:mRNA processing  
GO:0045892  P:negative regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF06003  SMN  
PROSITE View protein in PROSITE  
PS50304  TUDOR  
CDD cd21182  Tudor_SMN_SPF30-like  
Amino Acid Sequences MEKADLETYQVQMSQVEIALSTDPANAELLSLRSELQELIELTEAAIAQAEAASSSKAESSRKAASSVPSKTWSAGDECLAKYSADGGYYPARITSVGGSADNRVYSIVFKGYNTTELVKSAEIKALPANYASIAPSSSNKRKLTKAEEEEREKKKKKNEKKLEVKAAKAKEQNNKQATWQKFAKKSEKKGVHIAGTAGTSIFKTPDNPLGKVGVTGSGKGMTEVISRGKHKFAPGEDTNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.08
11 0.09
12 0.1
13 0.08
14 0.08
15 0.09
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.11
22 0.1
23 0.1
24 0.12
25 0.11
26 0.12
27 0.12
28 0.11
29 0.11
30 0.11
31 0.1
32 0.07
33 0.07
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.07
44 0.1
45 0.12
46 0.14
47 0.19
48 0.24
49 0.25
50 0.27
51 0.27
52 0.3
53 0.36
54 0.37
55 0.35
56 0.33
57 0.33
58 0.32
59 0.31
60 0.26
61 0.21
62 0.19
63 0.18
64 0.18
65 0.17
66 0.18
67 0.17
68 0.16
69 0.13
70 0.13
71 0.11
72 0.08
73 0.08
74 0.09
75 0.11
76 0.11
77 0.11
78 0.1
79 0.1
80 0.09
81 0.1
82 0.08
83 0.08
84 0.08
85 0.09
86 0.09
87 0.1
88 0.11
89 0.1
90 0.09
91 0.07
92 0.07
93 0.07
94 0.07
95 0.08
96 0.08
97 0.08
98 0.1
99 0.1
100 0.11
101 0.12
102 0.13
103 0.11
104 0.12
105 0.13
106 0.11
107 0.11
108 0.1
109 0.11
110 0.09
111 0.1
112 0.1
113 0.09
114 0.09
115 0.08
116 0.08
117 0.07
118 0.07
119 0.07
120 0.06
121 0.06
122 0.06
123 0.09
124 0.16
125 0.22
126 0.29
127 0.33
128 0.36
129 0.4
130 0.46
131 0.5
132 0.53
133 0.55
134 0.56
135 0.59
136 0.64
137 0.68
138 0.69
139 0.71
140 0.67
141 0.65
142 0.67
143 0.71
144 0.74
145 0.76
146 0.8
147 0.81
148 0.87
149 0.91
150 0.92
151 0.86
152 0.8
153 0.77
154 0.69
155 0.65
156 0.6
157 0.57
158 0.55
159 0.59
160 0.64
161 0.6
162 0.57
163 0.57
164 0.6
165 0.56
166 0.53
167 0.52
168 0.5
169 0.54
170 0.6
171 0.65
172 0.65
173 0.7
174 0.74
175 0.76
176 0.72
177 0.73
178 0.7
179 0.63
180 0.55
181 0.47
182 0.38
183 0.3
184 0.26
185 0.17
186 0.12
187 0.09
188 0.09
189 0.09
190 0.08
191 0.1
192 0.14
193 0.22
194 0.26
195 0.27
196 0.28
197 0.29
198 0.29
199 0.27
200 0.25
201 0.22
202 0.19
203 0.18
204 0.18
205 0.17
206 0.17
207 0.17
208 0.17
209 0.12
210 0.12
211 0.14
212 0.18
213 0.22
214 0.26
215 0.28
216 0.32
217 0.34
218 0.38
219 0.42
220 0.4
221 0.44