Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3EGK7

Protein Details
Accession A0A0C3EGK7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
47-86NEKYSAKWKEKQKGKHYKRNHSKRRALSKKRGQRLAKDGSBasic
NLS Segment(s)
PositionSequence
53-83KWKEKQKGKHYKRNHSKRRALSKKRGQRLAK
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPPLLPYSPRFADSFLASPFPLMDSTNIPQHSPVHLQWEGEGEVELNEKYSAKWKEKQKGKHYKRNHSKRRALSKKRGQRLAKDGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.21
4 0.19
5 0.18
6 0.17
7 0.15
8 0.12
9 0.1
10 0.1
11 0.12
12 0.14
13 0.19
14 0.2
15 0.19
16 0.2
17 0.2
18 0.22
19 0.21
20 0.2
21 0.21
22 0.21
23 0.21
24 0.2
25 0.2
26 0.18
27 0.14
28 0.13
29 0.07
30 0.06
31 0.07
32 0.07
33 0.05
34 0.05
35 0.05
36 0.06
37 0.14
38 0.19
39 0.23
40 0.3
41 0.38
42 0.48
43 0.56
44 0.66
45 0.69
46 0.76
47 0.81
48 0.84
49 0.86
50 0.87
51 0.9
52 0.92
53 0.92
54 0.91
55 0.91
56 0.91
57 0.92
58 0.92
59 0.91
60 0.91
61 0.91
62 0.91
63 0.91
64 0.91
65 0.86
66 0.84