Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BN03

Protein Details
Accession A0A0C3BN03    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-29QSIVLVRRTPRRARRERRPVVEDSHydrophilic
NLS Segment(s)
PositionSequence
14-23TPRRARRERR
Subcellular Location(s) mito 16, cyto 7, cyto_nucl 6, nucl 3
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTPRRARRERRPVVEDSTNACTFRFQIALPFMGNLPDVPFRIHDFVFWWEENVVSYGYITAFSRMGDDTVIARINRHGYYARRPGAIVLLPTLALNSLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.62
4 0.7
5 0.79
6 0.86
7 0.88
8 0.9
9 0.89
10 0.85
11 0.79
12 0.74
13 0.69
14 0.6
15 0.53
16 0.49
17 0.41
18 0.36
19 0.31
20 0.25
21 0.21
22 0.2
23 0.17
24 0.1
25 0.13
26 0.14
27 0.16
28 0.15
29 0.14
30 0.13
31 0.12
32 0.12
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.11
40 0.13
41 0.13
42 0.11
43 0.12
44 0.13
45 0.16
46 0.15
47 0.14
48 0.11
49 0.12
50 0.12
51 0.11
52 0.09
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.08
64 0.08
65 0.07
66 0.08
67 0.07
68 0.09
69 0.12
70 0.11
71 0.11
72 0.14
73 0.17
74 0.17
75 0.19
76 0.22
77 0.23
78 0.33
79 0.41
80 0.42
81 0.39
82 0.39
83 0.38
84 0.38
85 0.35
86 0.27
87 0.19
88 0.17
89 0.16
90 0.15
91 0.15
92 0.1