Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3G275

Protein Details
Accession A0A0C3G275    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-52KGRPVSQCEKCRKLRQSKRVHSKCLCNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences ESCIKGHRSSSCKHSDRPLFEIKKKGRPVSQCEKCRKLRQSKRVHSKCLCNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.58
4 0.59
5 0.61
6 0.57
7 0.57
8 0.63
9 0.58
10 0.59
11 0.6
12 0.58
13 0.53
14 0.52
15 0.56
16 0.57
17 0.62
18 0.62
19 0.66
20 0.71
21 0.73
22 0.77
23 0.79
24 0.79
25 0.8
26 0.82
27 0.85
28 0.88
29 0.91
30 0.9
31 0.9
32 0.86