Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3F3J2

Protein Details
Accession A0A0C3F3J2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-28SIVLVRRTSRRARRERHPVVEDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRARRERHPVVEDSTNARRVRFRITLPFMGNIPGVPFQIHDFVFWWEESVVSYGYITAFSRMSDFIDPFFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.55
4 0.62
5 0.68
6 0.76
7 0.81
8 0.84
9 0.83
10 0.78
11 0.7
12 0.65
13 0.61
14 0.52
15 0.47
16 0.42
17 0.39
18 0.35
19 0.32
20 0.3
21 0.28
22 0.33
23 0.31
24 0.29
25 0.31
26 0.35
27 0.38
28 0.37
29 0.36
30 0.3
31 0.27
32 0.24
33 0.16
34 0.12
35 0.09
36 0.08
37 0.07
38 0.07
39 0.08
40 0.11
41 0.11
42 0.1
43 0.1
44 0.12
45 0.13
46 0.12
47 0.12
48 0.09
49 0.09
50 0.1
51 0.1
52 0.09
53 0.07
54 0.08
55 0.07
56 0.07
57 0.08
58 0.08
59 0.09
60 0.08
61 0.09
62 0.11
63 0.11
64 0.14
65 0.16
66 0.16