Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3B6V7

Protein Details
Accession A0A0C3B6V7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-72DEDKLSKEKEAKKQSQNQKKKDKKRBasic
NLS Segment(s)
PositionSequence
54-72KEKEAKKQSQNQKKKDKKR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTEEQKMEEGKRMFSIFAARMFEQRVLQAYRERVAQERQMQLLRELEDEDKLSKEKEAKKQSQNQKKKDKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.21
4 0.22
5 0.24
6 0.22
7 0.22
8 0.24
9 0.25
10 0.2
11 0.19
12 0.19
13 0.17
14 0.18
15 0.2
16 0.2
17 0.2
18 0.21
19 0.21
20 0.2
21 0.21
22 0.25
23 0.26
24 0.26
25 0.27
26 0.27
27 0.27
28 0.26
29 0.25
30 0.21
31 0.16
32 0.16
33 0.14
34 0.14
35 0.14
36 0.14
37 0.13
38 0.13
39 0.13
40 0.15
41 0.22
42 0.28
43 0.37
44 0.47
45 0.54
46 0.63
47 0.73
48 0.81
49 0.85
50 0.87
51 0.88
52 0.89