Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3GG36

Protein Details
Accession A0A0C3GG36    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-50LWFVRGTQLRRRRWRVRWNNQGACTGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, mito 2, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYHSQIHHPHSNHPLVVITVPILGLWFVRGTQLRRRRWRVRWNNQGACTGALVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.25
4 0.19
5 0.11
6 0.07
7 0.07
8 0.06
9 0.05
10 0.04
11 0.04
12 0.04
13 0.04
14 0.03
15 0.06
16 0.09
17 0.12
18 0.21
19 0.31
20 0.4
21 0.5
22 0.59
23 0.67
24 0.74
25 0.83
26 0.85
27 0.87
28 0.89
29 0.9
30 0.89
31 0.82
32 0.76
33 0.66
34 0.56