Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DJ54

Protein Details
Accession E9DJ54    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-92GTYLIKPRNKTRRSRKESRLLPCAGHydrophilic
NLS Segment(s)
PositionSequence
75-83RNKTRRSRK
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MSALYISTVRWRRNFPVVLYRVRLSPWPQVGAELGSGAERPLARWTTASKLQPWPKPSPRYCIAELPGTYLIKPRNKTRRSRKESRLLPCAGRNEGAVIYVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.53
4 0.52
5 0.53
6 0.52
7 0.48
8 0.4
9 0.37
10 0.37
11 0.3
12 0.33
13 0.3
14 0.29
15 0.28
16 0.27
17 0.27
18 0.23
19 0.19
20 0.12
21 0.09
22 0.06
23 0.06
24 0.05
25 0.06
26 0.06
27 0.06
28 0.1
29 0.11
30 0.11
31 0.12
32 0.14
33 0.17
34 0.22
35 0.23
36 0.23
37 0.3
38 0.36
39 0.39
40 0.42
41 0.46
42 0.49
43 0.56
44 0.55
45 0.54
46 0.52
47 0.53
48 0.51
49 0.47
50 0.41
51 0.37
52 0.35
53 0.32
54 0.3
55 0.26
56 0.23
57 0.23
58 0.27
59 0.28
60 0.32
61 0.39
62 0.46
63 0.54
64 0.64
65 0.71
66 0.77
67 0.8
68 0.86
69 0.86
70 0.86
71 0.87
72 0.85
73 0.82
74 0.75
75 0.71
76 0.67
77 0.62
78 0.55
79 0.47
80 0.39
81 0.33
82 0.28