Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AYH8

Protein Details
Accession A0A0C3AYH8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-30DAIVREEKSTRPRKNRLRKTEICNSIRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MTNDAIVREEKSTRPRKNRLRKTEICNSIRVGMPSTTADILKDPTPHCWIRVLAARAHDKAKQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.67
3 0.75
4 0.83
5 0.89
6 0.89
7 0.89
8 0.87
9 0.85
10 0.85
11 0.83
12 0.74
13 0.65
14 0.56
15 0.48
16 0.41
17 0.34
18 0.25
19 0.16
20 0.15
21 0.13
22 0.13
23 0.11
24 0.1
25 0.1
26 0.09
27 0.11
28 0.11
29 0.15
30 0.14
31 0.17
32 0.23
33 0.24
34 0.24
35 0.26
36 0.24
37 0.25
38 0.33
39 0.31
40 0.29
41 0.35
42 0.39
43 0.39
44 0.42