Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BTQ3

Protein Details
Accession A0A0C3BTQ3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MPKDSTKPKRKAAEKAEKAPRATKAKKDKNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
7-34KPKRKAAEKAEKAPRATKAKKDKNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKDSTKPKRKAAEKAEKAPRATKAKKDKNAPKRALSAYMFFSQDWRERIKTENPDAGFGEVGKLLGAKWKELDEDEKKPYIELAAKDKTRAETEKTAYEGKNGAGSGEGEADEGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.85
4 0.8
5 0.76
6 0.71
7 0.68
8 0.66
9 0.63
10 0.63
11 0.64
12 0.69
13 0.73
14 0.79
15 0.82
16 0.82
17 0.87
18 0.83
19 0.77
20 0.73
21 0.67
22 0.62
23 0.54
24 0.45
25 0.38
26 0.35
27 0.3
28 0.24
29 0.23
30 0.2
31 0.22
32 0.21
33 0.21
34 0.2
35 0.2
36 0.25
37 0.3
38 0.34
39 0.34
40 0.37
41 0.34
42 0.34
43 0.33
44 0.3
45 0.23
46 0.16
47 0.12
48 0.07
49 0.06
50 0.05
51 0.04
52 0.03
53 0.08
54 0.08
55 0.08
56 0.09
57 0.1
58 0.11
59 0.12
60 0.2
61 0.21
62 0.25
63 0.29
64 0.3
65 0.29
66 0.28
67 0.27
68 0.23
69 0.22
70 0.2
71 0.23
72 0.29
73 0.29
74 0.31
75 0.33
76 0.33
77 0.33
78 0.34
79 0.33
80 0.33
81 0.36
82 0.38
83 0.39
84 0.42
85 0.37
86 0.37
87 0.32
88 0.26
89 0.25
90 0.21
91 0.18
92 0.14
93 0.15
94 0.13
95 0.13
96 0.12
97 0.09