Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3GKS3

Protein Details
Accession A0A0C3GKS3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-31QSIVLVRRTSRRTRRERRPIVKDSTSHydrophilic
NLS Segment(s)
PositionSequence
16-23RRTRRERR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRTRRERRPIVKDSTSARRFRFQIALPFMGNLPGVPFQIHDFVFWWEESVVSYGYITAFSRMSDGTVIACINRHGYYAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.57
4 0.65
5 0.74
6 0.83
7 0.87
8 0.92
9 0.91
10 0.91
11 0.88
12 0.85
13 0.78
14 0.71
15 0.65
16 0.65
17 0.61
18 0.57
19 0.52
20 0.49
21 0.46
22 0.45
23 0.44
24 0.36
25 0.38
26 0.37
27 0.36
28 0.3
29 0.29
30 0.26
31 0.22
32 0.19
33 0.11
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.1
41 0.1
42 0.09
43 0.09
44 0.11
45 0.12
46 0.11
47 0.11
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.07
54 0.07
55 0.06
56 0.06
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.09
63 0.09
64 0.1
65 0.09
66 0.09
67 0.08
68 0.09
69 0.1
70 0.09
71 0.1
72 0.1
73 0.13
74 0.13