Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3FP20

Protein Details
Accession A0A0C3FP20    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-30QSIVLIKRTTRRTRRERRPVVEDLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.333, cyto 4, cyto_nucl 2.833
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLIKRTTRRTRRERRPVVEDLTNVGVFPSQLELLDVGIWPGLPFQIHDFFFWWELSVVTYDYVTAFARMGDGTIIARVKRYGCFASQPGAIVLLPIMALHSFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.59
4 0.67
5 0.78
6 0.87
7 0.9
8 0.91
9 0.88
10 0.86
11 0.81
12 0.76
13 0.69
14 0.58
15 0.5
16 0.42
17 0.34
18 0.27
19 0.21
20 0.15
21 0.11
22 0.1
23 0.08
24 0.05
25 0.05
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.04
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.06
40 0.1
41 0.1
42 0.11
43 0.12
44 0.13
45 0.14
46 0.14
47 0.12
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.05
57 0.07
58 0.06
59 0.06
60 0.06
61 0.05
62 0.06
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.07
69 0.09
70 0.09
71 0.1
72 0.12
73 0.14
74 0.15
75 0.19
76 0.19
77 0.2
78 0.25
79 0.26
80 0.28
81 0.27
82 0.27
83 0.22
84 0.21
85 0.19
86 0.13
87 0.11
88 0.08
89 0.07
90 0.05
91 0.06