Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3G919

Protein Details
Accession A0A0C3G919    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPTGPRRREPLETBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRKPTGPRRR
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPTGPRRREPLETAFTCLFCHHDKSVTVRLDRKEGLAQLVCRVCDQRYQSKVNHLTEPIDVYSEWIDAADAAQREEQTVRRGNPSSSRPIIPPAPPSDDDDDDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.9
3 0.85
4 0.8
5 0.75
6 0.71
7 0.69
8 0.59
9 0.55
10 0.48
11 0.42
12 0.37
13 0.31
14 0.27
15 0.2
16 0.23
17 0.19
18 0.2
19 0.21
20 0.26
21 0.34
22 0.35
23 0.36
24 0.37
25 0.38
26 0.39
27 0.38
28 0.35
29 0.29
30 0.25
31 0.25
32 0.22
33 0.2
34 0.21
35 0.21
36 0.2
37 0.18
38 0.18
39 0.15
40 0.18
41 0.21
42 0.24
43 0.28
44 0.32
45 0.32
46 0.4
47 0.46
48 0.44
49 0.42
50 0.35
51 0.31
52 0.28
53 0.28
54 0.19
55 0.14
56 0.11
57 0.1
58 0.1
59 0.08
60 0.08
61 0.06
62 0.06
63 0.05
64 0.05
65 0.07
66 0.07
67 0.07
68 0.09
69 0.09
70 0.1
71 0.12
72 0.15
73 0.18
74 0.24
75 0.25
76 0.3
77 0.32
78 0.34
79 0.4
80 0.42
81 0.45
82 0.43
83 0.43
84 0.39
85 0.43
86 0.44
87 0.4
88 0.41
89 0.38
90 0.4
91 0.39
92 0.42
93 0.43
94 0.41
95 0.4