Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3FVU1

Protein Details
Accession A0A0C3FVU1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-28SIVLVRRTSRRARHERRPIVEDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRARHERRPIVEDSTNAHRFRFQIALPFMGNLPGVPFQIHDFIFWWEESVILYGYITAFSRMSDAWVLCASTGGDRSSSYFSVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.53
4 0.61
5 0.69
6 0.78
7 0.83
8 0.86
9 0.83
10 0.79
11 0.72
12 0.67
13 0.6
14 0.51
15 0.44
16 0.43
17 0.42
18 0.38
19 0.34
20 0.3
21 0.28
22 0.29
23 0.27
24 0.19
25 0.2
26 0.21
27 0.23
28 0.21
29 0.21
30 0.18
31 0.16
32 0.15
33 0.08
34 0.08
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.09
41 0.1
42 0.09
43 0.09
44 0.1
45 0.11
46 0.11
47 0.11
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.08
64 0.1
65 0.12
66 0.11
67 0.12
68 0.13
69 0.13
70 0.12
71 0.13
72 0.11
73 0.1
74 0.12
75 0.11
76 0.11
77 0.12
78 0.15
79 0.19