Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AFP8

Protein Details
Accession A0A0C3AFP8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
98-117RLRSRAYTGCRCRGRRRVIIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 7, extr 5
Family & Domain DBs
Amino Acid Sequences MSSSSRVRGRSAPLAAAAGAGEVVAVETIDYRAESECSTTSTHPSSLGRPYTPSLPDDSSTCNLEAEAYLDTSQKDSRGALLEGRGASAVVMACTSWRLRSRAYTGCRCRGRRRVIIPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.25
4 0.18
5 0.1
6 0.07
7 0.05
8 0.04
9 0.03
10 0.03
11 0.02
12 0.02
13 0.02
14 0.03
15 0.03
16 0.04
17 0.04
18 0.05
19 0.06
20 0.07
21 0.07
22 0.09
23 0.09
24 0.11
25 0.13
26 0.13
27 0.16
28 0.17
29 0.17
30 0.17
31 0.18
32 0.18
33 0.22
34 0.23
35 0.2
36 0.21
37 0.22
38 0.23
39 0.23
40 0.21
41 0.19
42 0.18
43 0.18
44 0.17
45 0.18
46 0.17
47 0.17
48 0.16
49 0.13
50 0.11
51 0.11
52 0.1
53 0.08
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.09
60 0.1
61 0.09
62 0.09
63 0.09
64 0.1
65 0.12
66 0.13
67 0.13
68 0.13
69 0.15
70 0.14
71 0.14
72 0.13
73 0.1
74 0.09
75 0.08
76 0.07
77 0.05
78 0.05
79 0.05
80 0.05
81 0.07
82 0.08
83 0.12
84 0.17
85 0.19
86 0.22
87 0.28
88 0.35
89 0.42
90 0.49
91 0.55
92 0.59
93 0.66
94 0.73
95 0.74
96 0.78
97 0.79
98 0.81
99 0.8