Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3FK96

Protein Details
Accession A0A0C3FK96    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-29SIVLVRRSSRRTCRERRPVVEDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 7, cyto 2, extr 2, E.R. 2, pero 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRSSRRTCRERRPVVEDSTNARTFRFQIALPFMGNLPDVPFQIHDFVFWWEENVVSYGYITAFSRMGDVSAIAILLIFQFVDPFFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.54
4 0.61
5 0.7
6 0.79
7 0.82
8 0.86
9 0.84
10 0.82
11 0.77
12 0.73
13 0.68
14 0.59
15 0.53
16 0.51
17 0.47
18 0.39
19 0.34
20 0.29
21 0.26
22 0.26
23 0.22
24 0.16
25 0.15
26 0.19
27 0.2
28 0.18
29 0.17
30 0.14
31 0.13
32 0.12
33 0.09
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.1
41 0.1
42 0.08
43 0.08
44 0.1
45 0.11
46 0.1
47 0.1
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.08
66 0.07
67 0.06
68 0.06
69 0.06
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.03
77 0.04