Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9CUL2

Protein Details
Accession E9CUL2    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
225-247SRFFDKTGKRLPPRILKKHVCVDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.833, cyto_mito 5.666, cyto 5.5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MPLSGHPLPEIKVSFADVFKSSKTLREEAAAAALKRSLLEASNKEAEEAGPPPPPPKEPIPATEQKTEAKPAAPESGPGLAAKACPAEAATSTNSILEWTPEQDLQLLKMKAEYTPWRAISASIGKPVFALKDRWGVIQPKTSASRDKQKAQKEAKPTKLENEKTRERRVSFSEPIVTPDNDGARDADSSKKVLYLDEAFTLEDVILLNQIAARYDEDKWIRISSRFFDKTGKRLPPRILKKHVCVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.24
4 0.21
5 0.21
6 0.2
7 0.24
8 0.22
9 0.26
10 0.3
11 0.3
12 0.29
13 0.3
14 0.31
15 0.26
16 0.32
17 0.29
18 0.24
19 0.23
20 0.22
21 0.19
22 0.17
23 0.17
24 0.12
25 0.11
26 0.17
27 0.19
28 0.24
29 0.29
30 0.29
31 0.28
32 0.27
33 0.25
34 0.22
35 0.2
36 0.17
37 0.15
38 0.16
39 0.18
40 0.2
41 0.21
42 0.23
43 0.26
44 0.31
45 0.31
46 0.33
47 0.39
48 0.44
49 0.47
50 0.46
51 0.45
52 0.4
53 0.39
54 0.39
55 0.33
56 0.27
57 0.24
58 0.22
59 0.24
60 0.22
61 0.2
62 0.19
63 0.19
64 0.17
65 0.16
66 0.14
67 0.09
68 0.09
69 0.09
70 0.08
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.09
77 0.09
78 0.1
79 0.1
80 0.1
81 0.1
82 0.1
83 0.09
84 0.08
85 0.08
86 0.08
87 0.09
88 0.09
89 0.09
90 0.1
91 0.1
92 0.11
93 0.17
94 0.16
95 0.14
96 0.16
97 0.16
98 0.14
99 0.18
100 0.2
101 0.18
102 0.23
103 0.23
104 0.23
105 0.23
106 0.23
107 0.22
108 0.24
109 0.19
110 0.19
111 0.18
112 0.17
113 0.17
114 0.17
115 0.15
116 0.12
117 0.13
118 0.11
119 0.16
120 0.17
121 0.18
122 0.21
123 0.23
124 0.23
125 0.27
126 0.26
127 0.24
128 0.27
129 0.27
130 0.3
131 0.31
132 0.39
133 0.39
134 0.46
135 0.5
136 0.54
137 0.62
138 0.63
139 0.65
140 0.65
141 0.69
142 0.7
143 0.69
144 0.63
145 0.62
146 0.64
147 0.64
148 0.61
149 0.6
150 0.61
151 0.62
152 0.68
153 0.67
154 0.6
155 0.58
156 0.58
157 0.57
158 0.51
159 0.47
160 0.45
161 0.38
162 0.39
163 0.38
164 0.31
165 0.25
166 0.24
167 0.22
168 0.17
169 0.18
170 0.15
171 0.12
172 0.13
173 0.13
174 0.16
175 0.16
176 0.17
177 0.17
178 0.18
179 0.17
180 0.17
181 0.2
182 0.18
183 0.18
184 0.18
185 0.19
186 0.17
187 0.16
188 0.16
189 0.12
190 0.09
191 0.07
192 0.05
193 0.05
194 0.05
195 0.05
196 0.06
197 0.06
198 0.07
199 0.08
200 0.1
201 0.12
202 0.13
203 0.21
204 0.23
205 0.25
206 0.27
207 0.29
208 0.3
209 0.32
210 0.35
211 0.32
212 0.4
213 0.41
214 0.4
215 0.45
216 0.48
217 0.53
218 0.58
219 0.64
220 0.61
221 0.65
222 0.73
223 0.75
224 0.79
225 0.81
226 0.82
227 0.8