Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3FLY8

Protein Details
Accession A0A0C3FLY8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20QKKTEEKKDDEKKAKISRRLBasic
NLS Segment(s)
PositionSequence
11-20EKKAKISRRL
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences QKKTEEKKDDEKKAKISRRLSARVNEFFKPKPKADVATPAKVDELPPKIEQPTPVDPLENPATEAAAPAPVIEDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.75
4 0.72
5 0.72
6 0.72
7 0.68
8 0.65
9 0.64
10 0.62
11 0.6
12 0.55
13 0.5
14 0.47
15 0.5
16 0.47
17 0.41
18 0.38
19 0.36
20 0.35
21 0.33
22 0.4
23 0.37
24 0.36
25 0.36
26 0.31
27 0.29
28 0.27
29 0.26
30 0.21
31 0.19
32 0.18
33 0.18
34 0.2
35 0.21
36 0.22
37 0.24
38 0.25
39 0.27
40 0.27
41 0.27
42 0.26
43 0.24
44 0.29
45 0.3
46 0.24
47 0.2
48 0.17
49 0.17
50 0.16
51 0.16
52 0.11
53 0.09
54 0.08
55 0.07