Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3FW45

Protein Details
Accession A0A0C3FW45    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29QSIVLVRRTSRRARRERRPVVEDSHydrophilic
NLS Segment(s)
PositionSequence
16-22RRARRER
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRARRERRPVVEDSTNARRVRFLIALPFMGNIPGVPFQIHDFVFWWEESVVSYGYITAFSRMSDFVDPFFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.55
4 0.63
5 0.72
6 0.81
7 0.85
8 0.89
9 0.88
10 0.84
11 0.78
12 0.73
13 0.67
14 0.59
15 0.53
16 0.5
17 0.48
18 0.43
19 0.39
20 0.33
21 0.29
22 0.3
23 0.25
24 0.19
25 0.16
26 0.16
27 0.17
28 0.16
29 0.15
30 0.12
31 0.1
32 0.09
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.1
41 0.11
42 0.1
43 0.1
44 0.12
45 0.13
46 0.12
47 0.12
48 0.09
49 0.09
50 0.1
51 0.1
52 0.09
53 0.07
54 0.08
55 0.07
56 0.07
57 0.08
58 0.08
59 0.09
60 0.08
61 0.09
62 0.11
63 0.11
64 0.14
65 0.16
66 0.16