Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3F7J9

Protein Details
Accession A0A0C3F7J9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-30QSIVLVRRTSRRTRRERRPVVEDPTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRTRRERRPVVEDPTNARRFRFQIALPFMGNLPGVPFQIHDFVFWWEESVVSYGYITAFSRMSNFVDPSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.57
4 0.64
5 0.74
6 0.83
7 0.87
8 0.91
9 0.88
10 0.86
11 0.83
12 0.79
13 0.75
14 0.67
15 0.62
16 0.61
17 0.6
18 0.51
19 0.45
20 0.41
21 0.36
22 0.36
23 0.33
24 0.25
25 0.27
26 0.3
27 0.31
28 0.28
29 0.26
30 0.23
31 0.2
32 0.18
33 0.1
34 0.07
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.1
41 0.11
42 0.1
43 0.1
44 0.12
45 0.13
46 0.12
47 0.12
48 0.09
49 0.09
50 0.1
51 0.1
52 0.09
53 0.07
54 0.08
55 0.07
56 0.07
57 0.08
58 0.08
59 0.09
60 0.09
61 0.09
62 0.11
63 0.13
64 0.16
65 0.18
66 0.2