Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DEI4

Protein Details
Accession E9DEI4   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-47IGVRIFKKRKLPGRPAKIGRRIRLBasic
89-108QCGFRQLKLRETRRRPREMFHydrophilic
NLS Segment(s)
PositionSequence
29-45FKKRKLPGRPAKIGRRI
Subcellular Location(s) mito 14, nucl 9, cyto 3
Family & Domain DBs
Amino Acid Sequences MTVLLYVREQRTGLPPNQINLRLIGVRIFKKRKLPGRPAKIGRRIRLFCRRCQAVRTCCEVLSVGNWEKSNSSIRLSSEAFECPQSLDQCGFRQLKLRETRRRPREMFCPEDLVSTTKQSSPATSDLITATTVYLSHWREEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.47
5 0.47
6 0.4
7 0.35
8 0.35
9 0.26
10 0.24
11 0.24
12 0.23
13 0.27
14 0.35
15 0.39
16 0.41
17 0.49
18 0.57
19 0.63
20 0.67
21 0.72
22 0.74
23 0.78
24 0.83
25 0.83
26 0.84
27 0.85
28 0.82
29 0.78
30 0.77
31 0.71
32 0.69
33 0.71
34 0.66
35 0.62
36 0.63
37 0.62
38 0.54
39 0.57
40 0.57
41 0.54
42 0.55
43 0.55
44 0.47
45 0.41
46 0.4
47 0.34
48 0.25
49 0.18
50 0.19
51 0.14
52 0.14
53 0.15
54 0.14
55 0.14
56 0.16
57 0.18
58 0.14
59 0.15
60 0.14
61 0.14
62 0.18
63 0.18
64 0.17
65 0.15
66 0.15
67 0.14
68 0.13
69 0.13
70 0.1
71 0.12
72 0.12
73 0.12
74 0.13
75 0.14
76 0.14
77 0.21
78 0.21
79 0.19
80 0.26
81 0.27
82 0.34
83 0.42
84 0.5
85 0.54
86 0.63
87 0.73
88 0.75
89 0.83
90 0.78
91 0.74
92 0.74
93 0.72
94 0.68
95 0.6
96 0.57
97 0.48
98 0.46
99 0.41
100 0.34
101 0.27
102 0.24
103 0.23
104 0.18
105 0.22
106 0.2
107 0.21
108 0.23
109 0.24
110 0.24
111 0.23
112 0.22
113 0.19
114 0.2
115 0.18
116 0.14
117 0.12
118 0.09
119 0.08
120 0.09
121 0.15
122 0.16