Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3FJL2

Protein Details
Accession A0A0C3FJL2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-62VTRGAGFRKEKNKKKRGSYRGGEITBasic
NLS Segment(s)
PositionSequence
43-54GFRKEKNKKKRG
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences RIKPRERTAEELEFDNRYELKAAPTNDYGAKAHKDLIVTRGAGFRKEKNKKKRGSYRGGEITMQSHSFKFTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.24
4 0.17
5 0.17
6 0.14
7 0.15
8 0.2
9 0.21
10 0.22
11 0.23
12 0.24
13 0.23
14 0.25
15 0.21
16 0.19
17 0.19
18 0.16
19 0.16
20 0.16
21 0.16
22 0.14
23 0.16
24 0.15
25 0.13
26 0.13
27 0.16
28 0.15
29 0.18
30 0.2
31 0.24
32 0.33
33 0.43
34 0.52
35 0.59
36 0.68
37 0.74
38 0.82
39 0.87
40 0.86
41 0.86
42 0.82
43 0.81
44 0.79
45 0.73
46 0.64
47 0.54
48 0.46
49 0.39
50 0.35
51 0.27
52 0.19