Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BVR7

Protein Details
Accession A0A0C3BVR7    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-37SSEYEDPPRRPSRNRRGRSRTPRSLSAGHydrophilic
NLS Segment(s)
PositionSequence
17-32PRRPSRNRRGRSRTPR
52-55RRGK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSQPRAASVSSEYEDPPRRPSRNRRGRSRTPRSLSAGSDEPQHSPHHPPANRRGKNKGGLPAVDEAEDTTRAVANTPRDTATKLAETVAQNKDDGGKEDSTLSLRLDLNLDVYVKLTAKVHGDITLTLFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.39
4 0.43
5 0.47
6 0.55
7 0.65
8 0.69
9 0.73
10 0.8
11 0.83
12 0.84
13 0.9
14 0.91
15 0.91
16 0.9
17 0.85
18 0.82
19 0.77
20 0.71
21 0.61
22 0.54
23 0.47
24 0.37
25 0.36
26 0.31
27 0.25
28 0.24
29 0.24
30 0.22
31 0.23
32 0.28
33 0.33
34 0.35
35 0.39
36 0.48
37 0.57
38 0.61
39 0.61
40 0.62
41 0.59
42 0.61
43 0.6
44 0.56
45 0.47
46 0.41
47 0.39
48 0.34
49 0.28
50 0.22
51 0.18
52 0.11
53 0.09
54 0.09
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.09
61 0.12
62 0.14
63 0.15
64 0.17
65 0.17
66 0.18
67 0.19
68 0.19
69 0.16
70 0.15
71 0.14
72 0.17
73 0.18
74 0.22
75 0.23
76 0.21
77 0.2
78 0.2
79 0.23
80 0.19
81 0.21
82 0.19
83 0.17
84 0.17
85 0.17
86 0.18
87 0.17
88 0.17
89 0.14
90 0.14
91 0.14
92 0.14
93 0.15
94 0.14
95 0.14
96 0.14
97 0.14
98 0.11
99 0.11
100 0.12
101 0.11
102 0.13
103 0.12
104 0.13
105 0.15
106 0.17
107 0.18
108 0.18
109 0.19
110 0.18