Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3FEW2

Protein Details
Accession A0A0C3FEW2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-29QSIVLVRRTLRRTRRERRPVVEDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTLRRTRRERRPVVEDSTNARRVRFQIALPFMGNIPGVPFQIHDFVFWWEESVVLYGYITAFSHMSDDTVIARINRHGYYARRPGAIVLLPTSALNSLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.53
4 0.62
5 0.72
6 0.81
7 0.84
8 0.87
9 0.86
10 0.84
11 0.79
12 0.75
13 0.7
14 0.61
15 0.57
16 0.55
17 0.54
18 0.47
19 0.41
20 0.37
21 0.34
22 0.37
23 0.32
24 0.26
25 0.27
26 0.29
27 0.3
28 0.28
29 0.26
30 0.2
31 0.19
32 0.17
33 0.09
34 0.08
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.1
41 0.1
42 0.09
43 0.09
44 0.1
45 0.11
46 0.1
47 0.1
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.05
54 0.05
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.09
70 0.08
71 0.1
72 0.12
73 0.16
74 0.15
75 0.17
76 0.21
77 0.24
78 0.33
79 0.41
80 0.42
81 0.39
82 0.39
83 0.38
84 0.38
85 0.35
86 0.28
87 0.2
88 0.18
89 0.17
90 0.17
91 0.17
92 0.13