Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3F8T0

Protein Details
Accession A0A0C3F8T0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
14-42CRFRTQRAGTRRQYCRRRQPQFIRPHQSRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MHHFPALVLACAFCRFRTQRAGTRRQYCRRRQPQFIRPHQSRRHMPVDVHLSSYMSPSACS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.24
4 0.33
5 0.38
6 0.43
7 0.52
8 0.61
9 0.62
10 0.69
11 0.75
12 0.76
13 0.79
14 0.8
15 0.83
16 0.84
17 0.82
18 0.82
19 0.82
20 0.82
21 0.83
22 0.83
23 0.81
24 0.76
25 0.8
26 0.77
27 0.76
28 0.74
29 0.7
30 0.67
31 0.61
32 0.55
33 0.53
34 0.53
35 0.45
36 0.41
37 0.34
38 0.29
39 0.26
40 0.27
41 0.21