Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BVP9

Protein Details
Accession A0A0C3BVP9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-30QSIVLVRRTSRRTRRERRPVVEDSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRTRRERRPVVEDSTNARHFRFQIALPFMGNIPGVPFQIHDFVFWWEESVVSYGYITAFSRMSDFVNPFFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.57
4 0.64
5 0.74
6 0.83
7 0.87
8 0.91
9 0.88
10 0.85
11 0.8
12 0.76
13 0.7
14 0.61
15 0.55
16 0.52
17 0.49
18 0.42
19 0.37
20 0.32
21 0.28
22 0.28
23 0.24
24 0.18
25 0.19
26 0.21
27 0.21
28 0.19
29 0.19
30 0.16
31 0.14
32 0.13
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.1
41 0.11
42 0.1
43 0.1
44 0.12
45 0.13
46 0.12
47 0.12
48 0.09
49 0.09
50 0.1
51 0.1
52 0.09
53 0.07
54 0.08
55 0.07
56 0.07
57 0.08
58 0.08
59 0.09
60 0.08
61 0.09
62 0.11
63 0.11
64 0.13
65 0.17
66 0.19