Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3EW78

Protein Details
Accession A0A0C3EW78    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-46IYSRRNLPFPQRRRTPRTAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8.5, cyto_nucl 7.5, mito 6, cyto 5.5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR016460  COPB1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0006886  P:intracellular protein transport  
Amino Acid Sequences MELSSMASDSGPIVSRASHTKPTFKQIYSRRNLPFPQRRRTPRTAGPDLPLLLGTSSFLRAVFAVYAIYRGMENLVPDARELLQTLAAASGATCKRNAFVFLAHCAIPKVVEWILSVYEQISGLAELLQMSVNEVIRLDRKNDSAYRARYIRCIFELLNTLSHAVKYKAAITLMTLTQNMAAVKAAASCFINLALKTCALAALMNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.19
4 0.24
5 0.31
6 0.33
7 0.41
8 0.44
9 0.53
10 0.57
11 0.52
12 0.57
13 0.58
14 0.65
15 0.64
16 0.69
17 0.64
18 0.64
19 0.68
20 0.7
21 0.7
22 0.68
23 0.71
24 0.73
25 0.78
26 0.79
27 0.81
28 0.78
29 0.77
30 0.77
31 0.75
32 0.68
33 0.62
34 0.56
35 0.49
36 0.42
37 0.33
38 0.24
39 0.16
40 0.12
41 0.1
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.06
59 0.06
60 0.07
61 0.08
62 0.09
63 0.08
64 0.08
65 0.1
66 0.09
67 0.08
68 0.09
69 0.07
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.05
76 0.04
77 0.09
78 0.09
79 0.1
80 0.1
81 0.11
82 0.11
83 0.12
84 0.14
85 0.1
86 0.11
87 0.12
88 0.14
89 0.15
90 0.14
91 0.14
92 0.13
93 0.11
94 0.09
95 0.08
96 0.08
97 0.07
98 0.07
99 0.07
100 0.08
101 0.09
102 0.09
103 0.09
104 0.06
105 0.06
106 0.06
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.03
114 0.04
115 0.04
116 0.04
117 0.05
118 0.06
119 0.06
120 0.06
121 0.06
122 0.07
123 0.11
124 0.12
125 0.14
126 0.15
127 0.17
128 0.22
129 0.24
130 0.28
131 0.33
132 0.35
133 0.39
134 0.41
135 0.4
136 0.42
137 0.42
138 0.4
139 0.34
140 0.33
141 0.27
142 0.25
143 0.3
144 0.24
145 0.23
146 0.2
147 0.2
148 0.17
149 0.18
150 0.18
151 0.14
152 0.14
153 0.14
154 0.15
155 0.16
156 0.17
157 0.16
158 0.15
159 0.17
160 0.17
161 0.17
162 0.16
163 0.13
164 0.13
165 0.15
166 0.13
167 0.1
168 0.09
169 0.08
170 0.08
171 0.1
172 0.1
173 0.09
174 0.1
175 0.1
176 0.1
177 0.12
178 0.15
179 0.13
180 0.16
181 0.16
182 0.15
183 0.16
184 0.15
185 0.14
186 0.11