Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3F990

Protein Details
Accession A0A0C3F990    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-40LLSNKCTKLKKYRNCLRRHLLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MRWYVLPQCTRDRNEKGILLSNKCTKLKKYRNCLRRHLLPIFCVMLPQAEKWEKGGGASLRGGVLFRRDFSVLTCLCLRLPCPGSSQATIRHCDSPKVGNSGPLSQNERVGMVNTSLPSFAGAIKETATNKKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.51
4 0.52
5 0.54
6 0.5
7 0.5
8 0.51
9 0.52
10 0.53
11 0.53
12 0.51
13 0.56
14 0.62
15 0.65
16 0.69
17 0.73
18 0.77
19 0.81
20 0.84
21 0.8
22 0.79
23 0.77
24 0.73
25 0.65
26 0.57
27 0.53
28 0.46
29 0.37
30 0.28
31 0.21
32 0.16
33 0.14
34 0.13
35 0.16
36 0.15
37 0.15
38 0.17
39 0.18
40 0.15
41 0.15
42 0.18
43 0.13
44 0.13
45 0.13
46 0.12
47 0.1
48 0.1
49 0.1
50 0.07
51 0.1
52 0.09
53 0.09
54 0.1
55 0.1
56 0.11
57 0.12
58 0.17
59 0.13
60 0.15
61 0.15
62 0.14
63 0.14
64 0.14
65 0.14
66 0.14
67 0.16
68 0.15
69 0.18
70 0.21
71 0.23
72 0.25
73 0.26
74 0.28
75 0.29
76 0.31
77 0.3
78 0.34
79 0.32
80 0.33
81 0.33
82 0.31
83 0.31
84 0.35
85 0.33
86 0.32
87 0.33
88 0.37
89 0.37
90 0.36
91 0.38
92 0.33
93 0.35
94 0.3
95 0.28
96 0.23
97 0.22
98 0.18
99 0.14
100 0.16
101 0.14
102 0.14
103 0.13
104 0.13
105 0.12
106 0.11
107 0.11
108 0.1
109 0.11
110 0.11
111 0.12
112 0.16
113 0.19