Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BJE6

Protein Details
Accession A0A0C3BJE6    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-60ASTSRKRERENETPSQRHKREKAAERQRRKRERDRNNSNNASTHydrophilic
NLS Segment(s)
PositionSequence
23-51KRERENETPSQRHKREKAAERQRRKRERD
108-126RLAARDRQRKHRALIKQRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MDSSPRRDNGQSSLSTPASTSRKRERENETPSQRHKREKAAERQRRKRERDRNNSNNASTSRTGSNGMGAIMFPHSSHQQHHTSQAPPPDSSEPDLSPEERARQDKVRLAARDRQRKHRALIKQRKDRELGLDMGNEIVEVQYRDGQYQQVLEHELQHNPHGVLVNHEPPFPQGQLGGQTFASTLLLSFSCAPLLKQHLLRNLQMTNEELTSLEPIIADAWEHWDHQRRLHYAHQAADAAKSSSVLPGSSSAYAPVDQHMSNGTPSTPYAGEHAHQPSSASDFRTRFQRPLVAPSPFRTFTADTQTTTPTSTSTSNASGPPSDGIDHPEGRAQHADSSDLVQARGEAEGVVGRLERG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.31
4 0.32
5 0.34
6 0.37
7 0.43
8 0.47
9 0.56
10 0.62
11 0.69
12 0.71
13 0.73
14 0.76
15 0.79
16 0.78
17 0.78
18 0.82
19 0.85
20 0.83
21 0.83
22 0.8
23 0.79
24 0.8
25 0.8
26 0.82
27 0.82
28 0.86
29 0.87
30 0.92
31 0.93
32 0.93
33 0.92
34 0.92
35 0.92
36 0.92
37 0.92
38 0.93
39 0.92
40 0.91
41 0.89
42 0.8
43 0.76
44 0.66
45 0.61
46 0.51
47 0.44
48 0.35
49 0.3
50 0.3
51 0.23
52 0.23
53 0.18
54 0.17
55 0.13
56 0.11
57 0.11
58 0.09
59 0.09
60 0.07
61 0.09
62 0.13
63 0.15
64 0.18
65 0.23
66 0.27
67 0.29
68 0.35
69 0.37
70 0.36
71 0.38
72 0.42
73 0.4
74 0.34
75 0.36
76 0.34
77 0.32
78 0.32
79 0.31
80 0.24
81 0.25
82 0.27
83 0.24
84 0.24
85 0.24
86 0.25
87 0.27
88 0.29
89 0.3
90 0.33
91 0.38
92 0.39
93 0.42
94 0.45
95 0.44
96 0.46
97 0.5
98 0.54
99 0.6
100 0.6
101 0.65
102 0.67
103 0.68
104 0.68
105 0.69
106 0.69
107 0.7
108 0.76
109 0.76
110 0.77
111 0.79
112 0.78
113 0.73
114 0.64
115 0.58
116 0.5
117 0.43
118 0.34
119 0.28
120 0.22
121 0.2
122 0.18
123 0.12
124 0.08
125 0.05
126 0.05
127 0.04
128 0.05
129 0.08
130 0.09
131 0.1
132 0.1
133 0.11
134 0.11
135 0.12
136 0.11
137 0.09
138 0.11
139 0.11
140 0.14
141 0.15
142 0.16
143 0.15
144 0.16
145 0.16
146 0.14
147 0.15
148 0.13
149 0.11
150 0.13
151 0.16
152 0.2
153 0.19
154 0.2
155 0.19
156 0.18
157 0.2
158 0.16
159 0.13
160 0.08
161 0.08
162 0.12
163 0.12
164 0.12
165 0.1
166 0.1
167 0.1
168 0.1
169 0.09
170 0.05
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.06
178 0.06
179 0.06
180 0.08
181 0.12
182 0.15
183 0.18
184 0.22
185 0.27
186 0.3
187 0.31
188 0.32
189 0.29
190 0.27
191 0.23
192 0.21
193 0.16
194 0.13
195 0.12
196 0.09
197 0.08
198 0.09
199 0.08
200 0.06
201 0.05
202 0.05
203 0.05
204 0.05
205 0.04
206 0.04
207 0.08
208 0.09
209 0.1
210 0.13
211 0.21
212 0.22
213 0.27
214 0.33
215 0.31
216 0.34
217 0.39
218 0.44
219 0.39
220 0.41
221 0.38
222 0.34
223 0.32
224 0.29
225 0.24
226 0.17
227 0.13
228 0.12
229 0.1
230 0.1
231 0.1
232 0.08
233 0.08
234 0.09
235 0.11
236 0.11
237 0.11
238 0.11
239 0.12
240 0.12
241 0.12
242 0.11
243 0.12
244 0.11
245 0.12
246 0.12
247 0.12
248 0.12
249 0.13
250 0.12
251 0.1
252 0.1
253 0.12
254 0.11
255 0.11
256 0.12
257 0.13
258 0.14
259 0.19
260 0.22
261 0.2
262 0.2
263 0.2
264 0.19
265 0.23
266 0.25
267 0.22
268 0.25
269 0.26
270 0.29
271 0.37
272 0.39
273 0.36
274 0.38
275 0.42
276 0.37
277 0.45
278 0.49
279 0.46
280 0.46
281 0.47
282 0.5
283 0.44
284 0.43
285 0.38
286 0.35
287 0.32
288 0.39
289 0.37
290 0.32
291 0.33
292 0.35
293 0.31
294 0.29
295 0.26
296 0.17
297 0.18
298 0.18
299 0.17
300 0.18
301 0.2
302 0.21
303 0.23
304 0.24
305 0.22
306 0.22
307 0.21
308 0.2
309 0.18
310 0.17
311 0.2
312 0.23
313 0.23
314 0.23
315 0.26
316 0.25
317 0.26
318 0.29
319 0.25
320 0.25
321 0.24
322 0.25
323 0.22
324 0.24
325 0.25
326 0.23
327 0.21
328 0.17
329 0.16
330 0.15
331 0.15
332 0.12
333 0.08
334 0.07
335 0.09
336 0.09
337 0.1