Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3FHU7

Protein Details
Accession A0A0C3FHU7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27SSGGGKAAKKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
5-21GKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 15.5, cyto_nucl 9, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences SSGGGKAAKKKKWSKGKVKDKAQHAVTLDKPTYDRILKEVPTFKFISQSILIERLKVNGSLARVAIRHLEKEGQIKRIVHHSGQLVYSALSWTSCFIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.91
4 0.91
5 0.92
6 0.89
7 0.85
8 0.83
9 0.74
10 0.67
11 0.58
12 0.54
13 0.46
14 0.44
15 0.37
16 0.29
17 0.28
18 0.25
19 0.27
20 0.23
21 0.21
22 0.19
23 0.22
24 0.23
25 0.27
26 0.31
27 0.28
28 0.3
29 0.31
30 0.27
31 0.27
32 0.25
33 0.24
34 0.18
35 0.18
36 0.15
37 0.19
38 0.19
39 0.16
40 0.16
41 0.14
42 0.14
43 0.13
44 0.13
45 0.1
46 0.11
47 0.11
48 0.12
49 0.12
50 0.11
51 0.12
52 0.16
53 0.16
54 0.16
55 0.16
56 0.18
57 0.19
58 0.28
59 0.31
60 0.3
61 0.33
62 0.33
63 0.33
64 0.39
65 0.4
66 0.32
67 0.33
68 0.32
69 0.3
70 0.29
71 0.29
72 0.21
73 0.18
74 0.17
75 0.14
76 0.11
77 0.09
78 0.09