Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3EZ33

Protein Details
Accession A0A0C3EZ33    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-30QSIVLVRRTSRRTRRERRPVVEDSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRTRRERRPVVEDSTNAHTFRFQVALPFMGNLPDVPFRIHDFVFWWEENVVSYGYITAFSRMSDDTVIARINRHGYYARRPGAIVLLPTSALNSLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.57
4 0.65
5 0.75
6 0.84
7 0.87
8 0.91
9 0.88
10 0.86
11 0.81
12 0.77
13 0.71
14 0.62
15 0.54
16 0.5
17 0.45
18 0.38
19 0.32
20 0.26
21 0.21
22 0.21
23 0.18
24 0.11
25 0.11
26 0.12
27 0.13
28 0.12
29 0.12
30 0.11
31 0.1
32 0.1
33 0.07
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.11
40 0.13
41 0.13
42 0.11
43 0.12
44 0.13
45 0.16
46 0.15
47 0.14
48 0.11
49 0.12
50 0.12
51 0.11
52 0.09
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.1
69 0.12
70 0.11
71 0.12
72 0.13
73 0.17
74 0.16
75 0.18
76 0.21
77 0.24
78 0.33
79 0.41
80 0.42
81 0.39
82 0.39
83 0.38
84 0.38
85 0.35
86 0.28
87 0.2
88 0.18
89 0.17
90 0.17
91 0.17
92 0.13