Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D707

Protein Details
Accession E9D707   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-79NLDPSRLRRRRYSPRAREKLDWVKEHydrophilic
NLS Segment(s)
PositionSequence
64-64R
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MFPDDSYLLLLIHYCSSVGGDDVEDGLDDKLEDIGACLLNEEEHPPEHYLEEEANLDPSRLRRRRYSPRAREKLDWVKEHWEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.07
5 0.07
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.05
12 0.06
13 0.05
14 0.05
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.06
29 0.06
30 0.06
31 0.08
32 0.09
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.09
40 0.09
41 0.1
42 0.1
43 0.1
44 0.1
45 0.16
46 0.25
47 0.3
48 0.34
49 0.4
50 0.5
51 0.61
52 0.71
53 0.77
54 0.78
55 0.84
56 0.89
57 0.87
58 0.83
59 0.82
60 0.81
61 0.78
62 0.71
63 0.64