Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3G7V4

Protein Details
Accession A0A0C3G7V4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-32QSIVLVRRTSRRTRRKRRPIVEDSTNAHydrophilic
NLS Segment(s)
PositionSequence
13-23RTSRRTRRKRR
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 3.5, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRTRRKRRPIVEDSTNARRFRFQIALPFMGNLPGVPFQIHDFVFWWEESIVSYGYITAFSRMNDFVDPLFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.53
3 0.58
4 0.66
5 0.77
6 0.86
7 0.89
8 0.94
9 0.93
10 0.93
11 0.9
12 0.87
13 0.83
14 0.78
15 0.72
16 0.71
17 0.67
18 0.58
19 0.5
20 0.43
21 0.37
22 0.35
23 0.33
24 0.24
25 0.26
26 0.29
27 0.31
28 0.28
29 0.27
30 0.23
31 0.2
32 0.18
33 0.1
34 0.07
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.1
41 0.11
42 0.1
43 0.1
44 0.12
45 0.13
46 0.12
47 0.12
48 0.09
49 0.09
50 0.1
51 0.1
52 0.09
53 0.07
54 0.08
55 0.07
56 0.07
57 0.08
58 0.08
59 0.09
60 0.1
61 0.1
62 0.13
63 0.14
64 0.16
65 0.15
66 0.16