Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ANF4

Protein Details
Accession A0A0C3ANF4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-104LLEGKKKKKVTKGKGKKQVELSBasic
112-134VKGKGKGKAKAKKAKGGSKKTSGBasic
NLS Segment(s)
PositionSequence
86-100GKKKKKVTKGKGKKQ
112-137VKGKGKGKAKAKKAKGGSKKTSGPSK
Subcellular Location(s) mito 15, mito_nucl 12.333, nucl 7.5, cyto_nucl 6.666
Family & Domain DBs
Amino Acid Sequences MERSATWTHKKPTVQDIVGIYMSRSGYFNRSHKLFPKLSVTPGVSVIPEMLEWLEGKEDAPTQEAVWGDKKPSFAVLSDMLDLLEGKKKKKVTKGKGKKQVELSSHSEEEVVKGKGKGKAKAKKAKGGSKKTSGPSKSRQNDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.5
3 0.46
4 0.42
5 0.4
6 0.35
7 0.26
8 0.2
9 0.19
10 0.15
11 0.14
12 0.12
13 0.15
14 0.22
15 0.27
16 0.3
17 0.33
18 0.36
19 0.41
20 0.48
21 0.46
22 0.42
23 0.45
24 0.41
25 0.4
26 0.41
27 0.36
28 0.29
29 0.28
30 0.25
31 0.18
32 0.16
33 0.13
34 0.08
35 0.07
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.07
50 0.1
51 0.1
52 0.1
53 0.12
54 0.12
55 0.12
56 0.13
57 0.13
58 0.11
59 0.12
60 0.12
61 0.1
62 0.12
63 0.12
64 0.11
65 0.11
66 0.11
67 0.09
68 0.09
69 0.09
70 0.07
71 0.11
72 0.12
73 0.13
74 0.18
75 0.23
76 0.29
77 0.39
78 0.49
79 0.54
80 0.64
81 0.74
82 0.8
83 0.86
84 0.85
85 0.82
86 0.79
87 0.76
88 0.68
89 0.63
90 0.58
91 0.53
92 0.49
93 0.43
94 0.35
95 0.27
96 0.25
97 0.24
98 0.2
99 0.16
100 0.18
101 0.23
102 0.29
103 0.34
104 0.4
105 0.46
106 0.54
107 0.61
108 0.7
109 0.72
110 0.75
111 0.78
112 0.81
113 0.81
114 0.82
115 0.8
116 0.78
117 0.79
118 0.77
119 0.78
120 0.74
121 0.72
122 0.7
123 0.73