Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3C8M3

Protein Details
Accession A0A0C3C8M3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-24TDKILRRMMKRGQRGRKNISTHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MFTDKILRRMMKRGQRGRKNISTHLDGPSSSVERKTEVMGASDVPTNNASPIYLLPQIKAMCDAQKPGFYEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.83
4 0.84
5 0.83
6 0.79
7 0.75
8 0.7
9 0.65
10 0.57
11 0.51
12 0.43
13 0.35
14 0.3
15 0.26
16 0.22
17 0.17
18 0.16
19 0.14
20 0.14
21 0.15
22 0.14
23 0.14
24 0.12
25 0.12
26 0.11
27 0.12
28 0.11
29 0.12
30 0.11
31 0.1
32 0.11
33 0.1
34 0.1
35 0.09
36 0.08
37 0.07
38 0.08
39 0.1
40 0.15
41 0.15
42 0.15
43 0.2
44 0.2
45 0.2
46 0.22
47 0.2
48 0.2
49 0.22
50 0.27
51 0.25
52 0.3
53 0.32