Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3AEZ7

Protein Details
Accession A0A0C3AEZ7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29QSIVLVRRTSRRARRERRPVVEDSHydrophilic
NLS Segment(s)
PositionSequence
16-22RRARRER
Subcellular Location(s) mito 19, cyto 6.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRARRERRPVVEDSTNARTFRFQIALPFMGNLPDVPFRILVFVFWWEENVVSYGYITAFSRMGDDTVIARINRHGYYARRPGAIVLLPTSALNSLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.56
4 0.63
5 0.73
6 0.82
7 0.86
8 0.9
9 0.89
10 0.85
11 0.79
12 0.74
13 0.69
14 0.61
15 0.55
16 0.52
17 0.46
18 0.41
19 0.36
20 0.31
21 0.27
22 0.27
23 0.24
24 0.17
25 0.17
26 0.2
27 0.21
28 0.2
29 0.18
30 0.15
31 0.14
32 0.14
33 0.1
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.07
43 0.06
44 0.07
45 0.08
46 0.07
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.08
64 0.08
65 0.07
66 0.08
67 0.07
68 0.09
69 0.12
70 0.11
71 0.11
72 0.14
73 0.17
74 0.17
75 0.19
76 0.22
77 0.23
78 0.33
79 0.41
80 0.42
81 0.39
82 0.39
83 0.38
84 0.38
85 0.35
86 0.28
87 0.2
88 0.18
89 0.17
90 0.17
91 0.17
92 0.13