Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3ACY9

Protein Details
Accession A0A0C3ACY9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-29QSIVLVRRTSRRTRREHRPVVEDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRTRREHRPVVEDSTNARTFRFQIALPFMGNLPDVPFQIHKFVFWWEENVVSYGYITAFLRMSDDTVIARINRHGYYARRPGAIVLLPTSALNSLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.56
4 0.63
5 0.72
6 0.81
7 0.84
8 0.87
9 0.84
10 0.8
11 0.75
12 0.72
13 0.65
14 0.55
15 0.47
16 0.44
17 0.41
18 0.35
19 0.31
20 0.25
21 0.24
22 0.25
23 0.24
24 0.17
25 0.17
26 0.2
27 0.21
28 0.2
29 0.18
30 0.15
31 0.14
32 0.14
33 0.1
34 0.08
35 0.08
36 0.08
37 0.08
38 0.1
39 0.1
40 0.13
41 0.13
42 0.11
43 0.11
44 0.12
45 0.14
46 0.13
47 0.15
48 0.11
49 0.12
50 0.13
51 0.13
52 0.12
53 0.08
54 0.08
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.07
64 0.08
65 0.08
66 0.08
67 0.07
68 0.08
69 0.1
70 0.09
71 0.1
72 0.12
73 0.15
74 0.15
75 0.17
76 0.21
77 0.24
78 0.33
79 0.41
80 0.42
81 0.39
82 0.39
83 0.38
84 0.38
85 0.35
86 0.28
87 0.2
88 0.18
89 0.17
90 0.17
91 0.17
92 0.13