Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3EZI2

Protein Details
Accession A0A0C3EZI2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-61FDVRHRTKSRQNRARHPRPYSNCKRNSPKPSHHQSCPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MGIRSHPTGRASELRILTVCSPTVFDVRHRTKSRQNRARHPRPYSNCKRNSPKPSHHQSCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.3
4 0.26
5 0.22
6 0.19
7 0.13
8 0.13
9 0.12
10 0.14
11 0.13
12 0.15
13 0.23
14 0.28
15 0.37
16 0.4
17 0.43
18 0.5
19 0.6
20 0.67
21 0.66
22 0.69
23 0.71
24 0.79
25 0.85
26 0.85
27 0.83
28 0.82
29 0.82
30 0.85
31 0.85
32 0.84
33 0.83
34 0.83
35 0.85
36 0.85
37 0.87
38 0.85
39 0.84
40 0.85
41 0.87