Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3FI54

Protein Details
Accession A0A0C3FI54    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
5-32NVLSRLPKQVPRCERKRRSQDGQNNLCIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 6, nucl 5, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNLRNVLSRLPKQVPRCERKRRSQDGQNNLCIDRRYPQDSHHRSGPSSARLSMLPSWTDPLRLYTGVSILVLNVDCYWEGFVVLATFSYCIFASVFAFRICL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.75
4 0.79
5 0.81
6 0.85
7 0.89
8 0.88
9 0.86
10 0.87
11 0.86
12 0.86
13 0.83
14 0.78
15 0.7
16 0.61
17 0.55
18 0.45
19 0.36
20 0.3
21 0.28
22 0.27
23 0.25
24 0.3
25 0.39
26 0.44
27 0.47
28 0.47
29 0.44
30 0.4
31 0.43
32 0.41
33 0.35
34 0.31
35 0.27
36 0.22
37 0.21
38 0.23
39 0.19
40 0.17
41 0.13
42 0.11
43 0.13
44 0.12
45 0.13
46 0.12
47 0.12
48 0.13
49 0.13
50 0.13
51 0.11
52 0.11
53 0.1
54 0.1
55 0.08
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.06
62 0.05
63 0.06
64 0.07
65 0.06
66 0.06
67 0.05
68 0.06
69 0.05
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.1
81 0.12
82 0.14