Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3FQL7

Protein Details
Accession A0A0C3FQL7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
68-93HMLAHYEKKRPARRPRYKPAPVQLQTHydrophilic
NLS Segment(s)
PositionSequence
75-85KKRPARRPRYK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQSGQNETVAIRCEETECGSSFWFNLVLICNNSYCPGDGFIYSIWSAQGQSTIRRLGLTHMSDAWKEHMLAHYEKKRPARRPRYKPAPVQLQTRINSERERASRLRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.18
4 0.17
5 0.17
6 0.17
7 0.17
8 0.15
9 0.15
10 0.12
11 0.1
12 0.09
13 0.1
14 0.12
15 0.13
16 0.14
17 0.13
18 0.13
19 0.14
20 0.14
21 0.12
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.1
28 0.11
29 0.1
30 0.1
31 0.08
32 0.07
33 0.07
34 0.06
35 0.1
36 0.09
37 0.1
38 0.12
39 0.13
40 0.13
41 0.13
42 0.13
43 0.12
44 0.17
45 0.16
46 0.15
47 0.16
48 0.17
49 0.17
50 0.18
51 0.18
52 0.13
53 0.12
54 0.12
55 0.13
56 0.16
57 0.18
58 0.26
59 0.31
60 0.35
61 0.4
62 0.49
63 0.55
64 0.61
65 0.7
66 0.73
67 0.77
68 0.82
69 0.88
70 0.9
71 0.89
72 0.88
73 0.86
74 0.86
75 0.8
76 0.76
77 0.73
78 0.7
79 0.64
80 0.61
81 0.55
82 0.48
83 0.46
84 0.43
85 0.44
86 0.4
87 0.45